Du Søgte efter: Columbia+Biosciences


23.157  results were found

SearchResultCount:"23157"

Sort Results

Listevisning Easy View (new)

Tilfreds med din søgning? - rate den her.

Leverandør: Columbia Biosciences
Beskrivelse: Anti-c-Myc tag Mouse Monoclonal Antibody (Europium 1024) [clone: 9E10]

Varenummer: (COBSD5-1714)
Leverandør: Columbia Biosciences
Beskrivelse: Anti-c-Myc tag Mouse Monoclonal Antibody (RPE (R-Phycoerythrin)) [clone: 9E10]
UOM: 1 * 1 Each


Varenummer: (COBSD11-1711)
Leverandør: Columbia Biosciences
Beskrivelse: Anti-6X His tag Mouse Monoclonal Antibody (Peridinin Chlorophyll) [clone: AD1.1.10]
UOM: 1 * 1 Each


Varenummer: (COBSAP-1718)
Leverandør: Columbia Biosciences
Beskrivelse: Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (AP (Alkaline Phosphatase)) [clone: M2]
UOM: 1 * 1 Each


Varenummer: (COBSD9-1711)
Leverandør: Columbia Biosciences
Beskrivelse: Anti-6X His tag Mouse Monoclonal Antibody (DyLight® 550) [clone: AD1.1.10]
UOM: 1 * 1 Each


Varenummer: (COBSD9-1722)
Leverandør: Columbia Biosciences
Beskrivelse: Anti-HA tag Mouse Monoclonal Antibody (DyLight® 550) [clone: 16B12]
UOM: 1 * 1 Each

Certifikater


Varenummer: (COBSD5-1601)
Leverandør: Columbia Biosciences
Beskrivelse: Mouse IgG1 Isotype Control (RPE (R-Phycoerythrin))
UOM: 1 * 1 Each


Varenummer: (COBSD5-1610)
Leverandør: Columbia Biosciences
Beskrivelse: Rabbit IgG Isotype Control (RPE (R-Phycoerythrin))
UOM: 1 * 1 Each


Varenummer: (COBSD9-1310)
Leverandør: Columbia Biosciences
Beskrivelse: Anti-schistosomal Glutathione-S-Transferase Goat Polyclonal Antibody (DyLight® 550)
UOM: 1 * 1 Each


Varenummer: (COBSD7-000)
Leverandør: Columbia Biosciences
Beskrivelse: SureLight™ P3 is a proprietary dye can be used in prompt fluorescent detection, microplate applications, flow cytometry and protein microarrays.
UOM: 1 * 5 mg


Varenummer: (COBSD3-1714-100)
Leverandør: Columbia Biosciences
Beskrivelse: Anti-c-Myc tag Mouse Monoclonal Antibody (APC (Allophycocyanin)) [clone: 9E10]
UOM: 1 * 1 Each


Varenummer: (COBSD5-1762)
Leverandør: Columbia Biosciences
Beskrivelse: Anti-Acetyl Lysine Mouse Monoclonal Antibody (RPE (R-Phycoerythrin)) [clone: 7F8]
UOM: 1 * 1 Each


Varenummer: (COBSD11-1714)
Leverandør: Columbia Biosciences
Beskrivelse: Anti-c-Myc tag Mouse Monoclonal Antibody (Peridinin Chlorophyll) [clone: 9E10]
UOM: 1 * 1 Each


Varenummer: (COBSD7-1714)
Leverandør: Columbia Biosciences
Beskrivelse: Anti-c-Myc tag Mouse Monoclonal Antibody SureLight® P3 [clone: 9E10]
UOM: 1 * 1 Each


Varenummer: (COBSD8-1714)
Leverandør: Columbia Biosciences
Beskrivelse: Anti-c-Myc tag Mouse Monoclonal Antibody (DyLight® 488) [clone: 9E10]
UOM: 1 * 1 Each


Varenummer: (COBSD3-1866-50)
Leverandør: Columbia Biosciences
Beskrivelse: Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 1 Each


Ring og spørg om pris
Lager for denne post er begrænset, men kan være til rådighed på et lager tæt på dig. Sørg for, at du er logget ind på webstedet, så tilgængelige bestand kan vises. Hvis call vises stadig, og du har brug for hjælp, bedes du ringe til os på - 43 86 87 88.
Lager for denne post er begrænset, men kan være til rådighed på et lager tæt på dig. Sørg for, at du er logget ind på webstedet, så tilgængelige bestand kan vises. Hvis call vises stadig, og du har brug for hjælp, bedes du ringe til os på - 43 86 87 88.
Dette produkt er mærket som begrænset og kan kun købes af godkendte Shipping konti. Hvis du har brug for yderligere hjælp, e-mail VWR Regulatory Department på Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
Dette produkt er blevet blokeret for salg via hjemmesiden. Kontakt kundeservice for mere information.
Det originale produkt er ikke længere tilgængelig. Den viste erstatning er tilgængelig.
Produkt (er) markeret med dette symbol er udgået - sælges indtil lageret er tomt. Alternativer kan være tilgængelige ved at søge med VWR-katalognummeret ovenfor. Hvis du har brug for yderligere hjælp, bedes du kontakte kundeservice på telefon 4386 8788
113 - 128 of 23.157
no targeter for Bottom